Structure of PDB 1zlk Chain B Binding Site BS02

Receptor Information
>1zlk Chain B (length=65) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGM
ERRTQAAVFATELKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zlk Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T166 N167 K179 K182 N183 S186 R196 R197
Binding residue
(residue number reindexed from 1)		T22 N23 K35 K38 N39 S42 R52 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zlk, PDBe:1zlk, PDBj:1zlk
PDBsum1zlk
PubMed16246368
UniProtP9WMF9|DEVR_MYCTU DNA-binding transcriptional activator DevR/DosR (Gene Name=devR)

[Back to BioLiP]