Structure of PDB 1zbi Chain B Binding Site BS02

Receptor Information
>1zbi Chain B (length=136) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMG
EFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALI
WKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zbi Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
N77 P78 T104 N105 N106 K138 W139 K146 S147 T148
Binding residue
(residue number reindexed from 1)
N19 P20 T46 N47 N48 K80 W81 K88 S89 T90
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1zbi, PDBe:1zbi, PDBj:1zbi
PDBsum1zbi
PubMed15989951
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]