Structure of PDB 1y19 Chain B Binding Site BS02

Receptor Information
>1y19 Chain B (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAG
FLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTY
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKR
WAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1y19 Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T354 N355 I356 K357 R358 W359 A360 Y377 I396
Binding residue
(residue number reindexed from 1)		T146 N147 I148 K149 R150 W151 A152 Y169 I188
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:1y19, PDBe:1y19, PDBj:1y19
PDBsum1y19
PubMed15623515
UniProtP26039|TLN1_MOUSE Talin-1 (Gene Name=Tln1)

[Back to BioLiP]