Structure of PDB 1xxp Chain B Binding Site BS02

Receptor Information
>1xxp Chain B (length=283) Species: 630 (Yersinia enterocolitica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRFRDIQCR
RQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVL
ASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLT
IREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYES
KGSSAVADDSKLRPVIHSRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQ
MRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xxp Two substrate-targeting sites in the Yersinia protein tyrosine phosphatase co-operate to promote bacterial virulence
Resolution3.0 Å
Binding residue
(original residue number in PDB)		F229 D231 Q357 S403 R404 A405 G406 V407 G408 R409 Q446
Binding residue
(residue number reindexed from 1)		F44 D46 Q172 S218 R219 A220 G221 V222 G223 R224 Q261
Enzymatic activity
Catalytic site (original residue number in PDB) E290 W354 D356 H402 S403 R409 T410
Catalytic site (residue number reindexed from 1) E105 W169 D171 H217 S218 R224 T225
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xxp, PDBe:1xxp, PDBj:1xxp
PDBsum1xxp
PubMed15720545
UniProtP15273|YOPH_YEREN Tyrosine-protein phosphatase YopH (Gene Name=yopH)

[Back to BioLiP]