Structure of PDB 1x11 Chain B Binding Site BS02

Receptor Information
>1x11 Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIFAANYLGSTQLLVRMMQAQEAVSRIKMAQKLAKSMTEVDLFILTQRIK
VLNADTQETMMDHPLRTISYIADIGNIVVLMARYKMICHVFESEDAQLIA
QSIGQAFSVAYQEFLRANGINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1x11 Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
M354 L413 R414 T415 I416 S417 Y418 I419 A420 D421 G423 R431 Q469 F479 Y483 F486
Binding residue
(residue number reindexed from 1)
M17 L65 R66 T67 I68 S69 Y70 I71 A72 D73 G75 R83 Q97 F107 Y111 F114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1x11, PDBe:1x11, PDBj:1x11
PDBsum1x11
PubMed9321393
UniProtQ02410|APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 (Gene Name=APBA1)

[Back to BioLiP]