Structure of PDB 1w0t Chain B Binding Site BS02

Receptor Information
>1w0t Chain B (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMK
KL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1w0t How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R380 W383 R415 D422 R423 K429
Binding residue
(residue number reindexed from 1)
R2 W5 R37 D44 R45 K51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1w0t, PDBe:1w0t, PDBj:1w0t
PDBsum1w0t
PubMed15608617
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]