Structure of PDB 1vto Chain B Binding Site BS02

Receptor Information

>1vto Chain B (length=188) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAV
IMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKF
KDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1vto Chain F (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcccttttatagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vto 1.9 A Resolution Refined Structure of TBP Recognizing the Minor Groove of TATAAAAG
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Q1026 N1027 R1056 F1057 I1061 R1063 T1070 T1082 V1119 P1149 F1165 S1167 K1169 V1171
Binding residue (residue number reindexed from 1)	Q16 N17 R46 F47 I51 R53 T60 T72 V109 P139 F155 S157 K159 V161

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vto, PDBe:1vto, PDBj:1vto
PDBsum	1vto
PubMed	7634103
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]