Structure of PDB 1u0c Chain B Binding Site BS02

Receptor Information
>1u0c Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSCKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u0c Isolation and characterization of new homing endonuclease specificities at individual target site positions.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G319 D320 G321 S322 Q326 K328 T346 E347 K348 R370 V373 K398 A433 N436 D437 S438 R441 K442
Binding residue
(residue number reindexed from 1)		G18 D19 G20 S21 Q25 K27 T45 E46 K47 R69 V72 K97 A132 N135 D136 S137 R140 K141
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Catalytic site (original residue number in PDB) G319 D320
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u0c, PDBe:1u0c, PDBj:1u0c
PDBsum1u0c
PubMed15313605
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]