Structure of PDB 1ty4 Chain B Binding Site BS02

Receptor Information
>1ty4 Chain B (length=166) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMG
TIFEKKHAENFETFCEQLLAVPRISFSPYQDVVRTVGNAQTDQCPMSYGR
LIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRS
WDDFMTLGKQMKEDYE
Ligand information
>1ty4 Chain D (length=27) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSIGYEIGSKLAAMCDDFDAQMMSYSA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ty4 Structural, Biochemical, and Functional Analyses of CED-9 Recognition by the Proapoptotic Proteins EGL-1 and CED-4
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F123 K126 H127 F134 Q137 D151 V152 T155 V156 Q163 S167 Y168 G169 R170 I172 Q230 M231 D234 Y235
Binding residue
(residue number reindexed from 1)		F53 K56 H57 F64 Q67 D81 V82 T85 V86 Q93 S97 Y98 G99 R100 I102 Q160 M161 D164 Y165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:1ty4, PDBe:1ty4, PDBj:1ty4
PDBsum1ty4
PubMed15383288
UniProtP41958|CED9_CAEEL Apoptosis regulator ced-9 (Gene Name=ced-9)

[Back to BioLiP]