Structure of PDB 1t39 Chain B Binding Site BS02

Receptor Information
>1t39 Chain B (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAI
EEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKA
ARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t39 DNA binding and nucleotide flipping by the human DNA repair protein AGT.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S93 F94 T95 R128 A129
Binding residue
(residue number reindexed from 1)		S67 F68 T69 R102 A103
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t39, PDBe:1t39, PDBj:1t39
PDBsum1t39
PubMed15221026
UniProtP16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Gene Name=MGMT)

[Back to BioLiP]