Structure of PDB 1sx8 Chain B Binding Site BS02

Receptor Information
>1sx8 Chain B (length=235) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIATTYTNKIKF
TLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVSLKTYNINELNEIP
KPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSED
EFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sx8 DNA Cleavage by EcoRV Endonuclease: Two Metal Ions in Three Metal Ion Binding Sites
Resolution2.15 Å
Binding residue
(original residue number in PDB)		T37 N70 A92 T93 T94 T106 G109 T111 K119 N120 G182 S183 T186 N188
Binding residue
(residue number reindexed from 1)		T36 N69 A91 T92 T93 T101 G104 T106 K114 N115 G172 S173 T176 N178
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1sx8, PDBe:1sx8, PDBj:1sx8
PDBsum1sx8
PubMed15170321
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]