Structure of PDB 1rio Chain B Binding Site BS02

Receptor Information
>1rio Chain B (length=96) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGAL
FNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rio Structure of a ternary transcription activation complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S2 K4 K20 Y23 K27 S33 Q34 Q45 N53
Binding residue
(residue number reindexed from 1)		S1 K3 K19 Y22 K26 S32 Q33 Q44 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1rio, PDBe:1rio, PDBj:1rio
PDBsum1rio
PubMed14731393
UniProtP03034|RPC1_LAMBD Repressor protein cI (Gene Name=cI)

[Back to BioLiP]