Structure of PDB 1r4i Chain B Binding Site BS02

Receptor Information
>1r4i Chain B (length=71) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKF
RRKNCPSCRLRKCYEAGMTLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r4i Structural basis of androgen receptor binding to selective androgen response elements.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		H553 Y554
Binding residue
(residue number reindexed from 1)		H14 Y15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r4i, PDBe:1r4i, PDBj:1r4i
PDBsum1r4i
PubMed15037741
UniProtP15207|ANDR_RAT Androgen receptor (Gene Name=Ar)

[Back to BioLiP]