Structure of PDB 1r2b Chain B Binding Site BS02

Receptor Information
>1r2b Chain B (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSG
LFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAV
MATAMYLQMEHVVDTCRKFIKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r2b Mechanism of SMRT corepressor recruitment by the BCL6 BTB domain.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
M51 A52 C53 H116 K123
Binding residue
(residue number reindexed from 1)
M46 A47 C48 H111 K118
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1r2b, PDBe:1r2b, PDBj:1r2b
PDBsum1r2b
PubMed14690607
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]