Structure of PDB 1r0o Chain B Binding Site BS02

Receptor Information
>1r0o Chain B (length=78) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDM
YMRRKCQECRLKKCLAVGMRPECVVPEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r0o Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex
Resolution2.24 Å
Binding residue
(original residue number in PDB)		Y17 H18 Y19 K28 R32 K58 V78
Binding residue
(residue number reindexed from 1)		Y14 H15 Y16 K25 R29 K55 V75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r0o, PDBe:1r0o, PDBj:1r0o
PDBsum1r0o
PubMed14592980
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]