Structure of PDB 1r0n Chain B Binding Site BS02

Receptor Information
>1r0n Chain B (length=86) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMY
MRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r0n Structure of the heterodimeric Ecdysone Receptor DNA-binding complex
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y211 Y213 K222 R226 R251 V272 K280
Binding residue
(residue number reindexed from 1)		Y13 Y15 K24 R28 R53 V74 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r0n, PDBe:1r0n, PDBj:1r0n
PDBsum1r0n
PubMed14592980
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]