Structure of PDB 1p71 Chain B Binding Site BS02

Receptor Information
>1p71 Chain B (length=93) Species: 1167 (Anabaena sp.) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSF
ESRERKAREGRNPKTNEKMEIPATRVPAFSAGKLFREKVAPPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p71 Flexible DNA bending in HU-DNA cocrystal structures
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R55 K56 R58 E59 R61 P63
Binding residue
(residue number reindexed from 1)		R55 K56 R58 E59 R61 P63
Binding affinityPDBbind-CN: Kd=3.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
GO:0043158 heterocyst development
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p71, PDBe:1p71, PDBj:1p71
PDBsum1p71
PubMed12853489
UniProtP05514|DBH_NOSS1 DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]