Structure of PDB 1owf Chain B Binding Site BS02

Receptor Information
>1owf Chain B (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1owf Integration Host Factor: putting a twist on protein-DNA recognition
Resolution1.95 Å
Binding residue
(original residue number in PDB)		A44 I45 R46 H54 R56 H79
Binding residue
(residue number reindexed from 1)		A44 I45 R46 H54 R56 H79
Binding affinityPDBbind-CN: Kd=4.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1owf, PDBe:1owf, PDBj:1owf
PDBsum1owf
PubMed12842466
UniProtP0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]