Structure of PDB 1ov3 Chain B Binding Site BS02

Receptor Information
>1ov3 Chain B (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAK
RGWIPASFLEPLDSPDEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVI
HKLLDGWWVIRKDDVTGYFPSMYLQKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ov3 Molecular basis of phosphorylation-induced activation of the NADPH oxidase
Resolution1.8 Å
Binding residue
(original residue number in PDB)
A165 S191 W193
Binding residue
(residue number reindexed from 1)
A14 S40 W42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ov3, PDBe:1ov3, PDBj:1ov3
PDBsum1ov3
PubMed12732142
UniProtP14598|NCF1_HUMAN Neutrophil cytosol factor 1 (Gene Name=NCF1)

[Back to BioLiP]