Structure of PDB 1ot7 Chain B Binding Site BS02

Receptor Information

>1ot7 Chain B (length=229) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TELTVDQQTLLDYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMAT
SHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPA
GHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILS
PDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQHFACLLGRLTELRT
FNHHHAEMLMSWRVNDHKFTPLLCEIWDV

Ligand information

>1ot7 Chain E (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENALLRYLLDKD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ot7 Structural Basis for Bile Acid Binding and Activation of the Nuclear Receptor FXR
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Q264 E286 T289 Q293 P460
Binding residue (residue number reindexed from 1)	Q25 E47 T50 Q54 P221

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ot7, PDBe:1ot7, PDBj:1ot7
PDBsum	1ot7
PubMed	12718893
UniProt	Q62735\|NR1H4_RAT Bile acid receptor (Gene Name=Nr1h4)

[Back to BioLiP]