Structure of PDB 1osv Chain B Binding Site BS02

Receptor Information
>1osv Chain B (length=229) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELTVDQQTLLDYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMAT
SHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPA
GHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILS
PDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQHFACLLGRLTELRT
FNHHHAEMLMSWRVNDHKFTPLLCEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1osv Structural Basis for Bile Acid Binding and Activation of the Nuclear Receptor FXR
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q264 E286 Q293
Binding residue
(residue number reindexed from 1)		Q25 E47 Q54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1osv, PDBe:1osv, PDBj:1osv
PDBsum1osv
PubMed12718893
UniProtQ62735|NR1H4_RAT Bile acid receptor (Gene Name=Nr1h4)

[Back to BioLiP]