Structure of PDB 1osl Chain B Binding Site BS02

Receptor Information
>1osl Chain B (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1osl Structure and flexibility adaptation in nonspecific and specific protein-DNA complexes.
ResolutionN/A
Binding residue
(original residue number in PDB)		S16 R22 H29 V30 S31 A57 G58 K59
Binding residue
(residue number reindexed from 1)		S16 R22 H29 V30 S31 A57 G58 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1osl, PDBe:1osl, PDBj:1osl
PDBsum1osl
PubMed15256668
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]