Structure of PDB 1nlw Chain B Binding Site BS02

Receptor Information
>1nlw Chain B (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQY
MRRKNHTHQQDIDDLKRQNALLEQQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nlw X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H207 N208 E211 R212 R215 K219 S238 R239
Binding residue
(residue number reindexed from 1)		H5 N6 E9 R10 R13 K17 S36 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1nlw, PDBe:1nlw, PDBj:1nlw
PDBsum1nlw
PubMed12553908
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]