Structure of PDB 1mnm Chain B Binding Site BS02

Receptor Information
>1mnm Chain B (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETG
LVYTFSTPKFEPIVTQQEGRNLIQACLNAPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mnm Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R18 R19 K20 S37 K38 K40 K46 T66 Y70
Binding residue
(residue number reindexed from 1)		R1 R2 K3 S20 K21 K23 K29 T49 Y53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mnm, PDBe:1mnm, PDBj:1mnm
PDBsum1mnm
PubMed9490409
UniProtP11746|MCM1_YEAST Pheromone receptor transcription factor (Gene Name=MCM1)

[Back to BioLiP]