Structure of PDB 1mdy Chain B Binding Site BS02

Receptor Information
>1mdy Chain B (length=62) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAI
RYIEGLQALLRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mdy Crystal structure of MyoD bHLH domain-DNA complex: perspectives on DNA recognition and implications for transcriptional activation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R117 E118
Binding residue
(residue number reindexed from 1)		R13 E14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007517 muscle organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mdy, PDBe:1mdy, PDBj:1mdy
PDBsum1mdy
PubMed8181063
UniProtP10085|MYOD1_MOUSE Myoblast determination protein 1 (Gene Name=Myod1)

[Back to BioLiP]