Structure of PDB 1le8 Chain B Binding Site BS02

Receptor Information
>1le8 Chain B (length=74) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVA
ARRAKEKTITIAPELADLLSGEPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1le8 Structural and Thermodynamic Characterization of the DNA Binding Properties of a Triple Alanine Mutant of MATalpha2
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H134 R135 F136 Q175 N178 W179
Binding residue
(residue number reindexed from 1)		H3 R4 F5 Q44 N47 W48
Binding affinityPDBbind-CN: Kd=4.51uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1le8, PDBe:1le8, PDBj:1le8
PDBsum1le8
PubMed12121651
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]