Structure of PDB 1kb2 Chain B Binding Site BS02

Receptor Information
>1kb2 Chain B (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKD
NRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kb2 Structural basis of VDR-DNA interactions on direct repeat response elements.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E242 R250 R273 R280
Binding residue
(residue number reindexed from 1)		E21 R29 R52 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kb2, PDBe:1kb2, PDBj:1kb2
PDBsum1kb2
PubMed11980721
UniProtP11473|VDR_HUMAN Vitamin D3 receptor (Gene Name=VDR)

[Back to BioLiP]