Structure of PDB 1k61 Chain B Binding Site BS02

Receptor Information
>1k61 Chain B (length=59) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVS
NRRRKEKTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k61 A Hoogsteen base pair embedded in undistorted B-DNA
Resolution2.1 Å
Binding residue
(original residue number in PDB)		H134 R135 F136 Q175 W179 N182
Binding residue
(residue number reindexed from 1)		H3 R4 F5 Q44 W48 N51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1k61, PDBe:1k61, PDBj:1k61
PDBsum1k61
PubMed12466549
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]