Structure of PDB 1jgg Chain B Binding Site BS02

Receptor Information
>1jgg Chain B (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNR
RMKDKRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jgg Structure of the even-skipped homeodomain complexed to AT-rich DNA: new perspectives on homeodomain specificity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R303 Y304 R328 M354
Binding residue
(residue number reindexed from 1)		R1 Y2 R26 M52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jgg, PDBe:1jgg, PDBj:1jgg
PDBsum1jgg
PubMed8557047
UniProtP06602|EVE_DROME Segmentation protein even-skipped (Gene Name=eve)

[Back to BioLiP]