Structure of PDB 1jfi Chain B Binding Site BS02

Receptor Information
>1jfi Chain B (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEIC
NKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRL
ENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jfi Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
Resolution2.62 Å
Binding residue
(original residue number in PDB)
R115 R201
Binding residue
(residue number reindexed from 1)
R7 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046982 protein heterodimerization activity
GO:0140223 general transcription initiation factor activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0045995 regulation of embryonic development
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051302 regulation of cell division
GO:0051726 regulation of cell cycle
GO:0090043 regulation of tubulin deacetylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0017054 negative cofactor 2 complex
GO:0072686 mitotic spindle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0140672 ATAC complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1jfi, PDBe:1jfi, PDBj:1jfi
PDBsum1jfi
PubMed11461703
UniProtQ01658|NC2B_HUMAN Protein Dr1 (Gene Name=DR1)

[Back to BioLiP]