Structure of PDB 1io4 Chain B Binding Site BS02

Receptor Information
>1io4 Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQ
KKVEQLSRELSTLRNLFKQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1io4 Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R280 K287 S288
Binding residue
(residue number reindexed from 1)		R16 K23 S24
Binding affinityPDBbind-CN: Kd=7.56nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1io4, PDBe:1io4, PDBj:1io4
PDBsum1io4
PubMed11257229
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]