Structure of PDB 1hlo Chain B Binding Site BS02

Receptor Information
>1hlo Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE
YIQYMRRKNHTHQQDIDDLKRQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hlo The crystal structure of an intact human Max-DNA complex: new insights into mechanisms of transcriptional control.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H18 N19 E22 R23 R26 S49 R50
Binding residue
(residue number reindexed from 1)		H9 N10 E13 R14 R17 S40 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1hlo, PDBe:1hlo, PDBj:1hlo
PDBsum1hlo
PubMed9115440
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]