Structure of PDB 1gji Chain B Binding Site BS02

Receptor Information

>1gji Chain B (length=275) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFG
KVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGI
QCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLP
DEHGNYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFIL
CDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPI
TVKMQLRRPSDQEVSEPMDFRYLPD

Ligand information

>1gji Chain D (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctggaatttctttaaaccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1gji X-ray crystal structure of proto-oncogene product c-Rel bound to the CD28 response element of IL-2.
Resolution	2.85 Å
Binding residue (original residue number in PDB)	Y24 C26 E27 K110 K111 K212 R237 Q238
Binding residue (residue number reindexed from 1)	Y18 C20 E21 K104 K105 K206 R231 Q232
Binding affinity	PDBbind-CN: Kd=25nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1gji, PDBe:1gji, PDBj:1gji
PDBsum	1gji
PubMed	11587641
UniProt	P16236\|REL_CHICK Proto-oncogene c-Rel (Gene Name=REL)

[Back to BioLiP]