Structure of PDB 1g1x Chain B Binding Site BS02

Receptor Information
>1g1x Chain B (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYREIVEKLGLRG
Ligand information
>1g1x Chain E (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgccgauggcgaaggcagccaccugguccacccgugacgcuuu
.........<<....>>...........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g1x Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		P1 R16 F17 D20 T21 G22 S23 T24 R34 R37 H41 H50 S51 R53 R64 Y68
Binding residue
(residue number reindexed from 1)		P1 R16 F17 D20 T21 G22 S23 T24 R34 R37 H41 H50 S51 R53 R64 Y68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g1x, PDBe:1g1x, PDBj:1g1x
PDBsum1g1x
PubMed10753109
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]