Structure of PDB 1f4k Chain B Binding Site BS02

Receptor Information
>1f4k Chain B (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f4k Structure of the RTP-DNA complex and the mechanism of polar replication fork arrest
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K14 Q15 R16 N53 T55 R59 E84
Binding residue
(residue number reindexed from 1)		K7 Q8 R9 N46 T48 R52 E77
Binding affinityPDBbind-CN: Kd=20pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f4k, PDBe:1f4k, PDBj:1f4k
PDBsum1f4k
PubMed11224562
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]