Structure of PDB 1eyu Chain B Binding Site BS02

Receptor Information
>1eyu Chain B (length=153) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL
PGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIFAIY
RGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVMEHGT
KIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyu PvuII endonuclease contains two calcium ions in active sites.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		Q33 H84 Y123 K130 N140 N141 P145
Binding residue
(residue number reindexed from 1)		Q32 H80 Y119 K126 N136 N137 P141
Enzymatic activity
Catalytic site (original residue number in PDB) D58 E68 K70
Catalytic site (residue number reindexed from 1) D54 E64 K66
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyu, PDBe:1eyu, PDBj:1eyu
PDBsum1eyu
PubMed10903853
UniProtP23657|T2P2_PROHU Type II restriction enzyme PvuII (Gene Name=pvuIIR)

[Back to BioLiP]