Structure of PDB 1eyg Chain B Binding Site BS02

Receptor Information
>1eyg Chain B (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTM
QMLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		A2001 N2013 G2015 T2033 A2035 S2037 E2050 T2052 W2054 H2055 R2056 F2060 K2073 G2074 R2084 R2086 W2088 Y2097 T2098 T2099 E2100 V2102 N2104 V2105 G2106
Binding residue
(residue number reindexed from 1)		A1 N13 G15 T33 A35 S37 E41 T43 W45 H46 R47 F51 K64 G65 R75 R77 W79 Y88 T89 T90 E91 V93 N95 V96 G97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
PDBsum1eyg
PubMed10932248
UniProtP0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]