Structure of PDB 1eqz Chain B Binding Site BS02

Receptor Information
>1eqz Chain B (length=108) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVN
DIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKA
VTKYTSSK
Ligand information
>1eqz Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R29 K31 R33 K34 E35 S36
Binding residue
(residue number reindexed from 1)		R12 K14 R16 K17 E18 S19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP0C1H5|H2B7_CHICK Histone H2B 7 (Gene Name=H2B-VII)

[Back to BioLiP]