Structure of PDB 1e9o Chain B Binding Site BS02

Receptor Information

>1e9o Chain B (length=151) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGD
NTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDP
LISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIA
K

Ligand information

Ligand ID

InChI

InChI=1S/Cu/q+2

InChIKey

JPVYNHNXODAKFH-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Cu+2]
CACTVS 3.341	[Cu++]

Formula

Name

COPPER (II) ION

PDB chain

1e9o Chain B Residue 153 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1e9o Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
Resolution	1.85 Å
Binding residue (original residue number in PDB)	H61 H69 H78 D81
Binding residue (residue number reindexed from 1)	H61 H69 H78 D81
Annotation score	1

Enzymatic activity

Catalytic site (original residue number in PDB)	H44 H46 H61 H69 H78 D81 H118 R141
Catalytic site (residue number reindexed from 1)	H44 H46 H61 H69 H78 D81 H118 R141
Enzyme Commision number	1.15.1.1: superoxide dismutase.

Gene Ontology

	Molecular Function
GO:0004784	superoxide dismutase activity
GO:0004842	ubiquitin-protein transferase activity
GO:0005507	copper ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016209	antioxidant activity
GO:0016491	oxidoreductase activity
GO:0030346	protein phosphatase 2B binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0051087	protein-folding chaperone binding

	Biological Process
GO:0000209	protein polyubiquitination
GO:0000303	response to superoxide
GO:0001541	ovarian follicle development
GO:0001819	positive regulation of cytokine production
GO:0001895	retina homeostasis
GO:0002262	myeloid cell homeostasis
GO:0006749	glutathione metabolic process
GO:0006801	superoxide metabolic process
GO:0006879	intracellular iron ion homeostasis
GO:0007283	spermatogenesis
GO:0007566	embryo implantation
GO:0007605	sensory perception of sound
GO:0007626	locomotory behavior
GO:0008217	regulation of blood pressure
GO:0009408	response to heat
GO:0019226	transmission of nerve impulse
GO:0019430	removal of superoxide radicals
GO:0032287	peripheral nervous system myelin maintenance
GO:0040014	regulation of multicellular organism growth
GO:0042542	response to hydrogen peroxide
GO:0043085	positive regulation of catalytic activity
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043410	positive regulation of MAPK cascade
GO:0043524	negative regulation of neuron apoptotic process
GO:0045471	response to ethanol
GO:0046716	muscle cell cellular homeostasis
GO:0048678	response to axon injury
GO:0050665	hydrogen peroxide biosynthetic process
GO:0051881	regulation of mitochondrial membrane potential
GO:0060047	heart contraction
GO:0060052	neurofilament cytoskeleton organization
GO:0060087	relaxation of vascular associated smooth muscle
GO:0060088	auditory receptor cell stereocilium organization
GO:0072593	reactive oxygen species metabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005777	peroxisome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0031410	cytoplasmic vesicle
GO:0032839	dendrite cytoplasm
GO:0032991	protein-containing complex
GO:0043025	neuronal cell body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1e9o, PDBe:1e9o, PDBj:1e9o
PDBsum	1e9o
PubMed	11080458
UniProt	P00442\|SODC_BOVIN Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]