Structure of PDB 1dz5 Chain B Binding Site BS02

Receptor Information
>1dz5 Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
V
Ligand information
>1dz5 Chain D (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagacauugcacccggagucuc
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dz5 The NMR Structure of the 38kDa U1A Protein-Pie RNA Complex Reveals the Basis of Cooperativity in Regulation of Polyadenylation by Human U1A Protein
ResolutionN/A
Binding residue
(original residue number in PDB)		S45 S47 L48
Binding residue
(residue number reindexed from 1)		S45 S47 L48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1dz5, PDBe:1dz5, PDBj:1dz5
PDBsum1dz5
PubMed10742179
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]