Structure of PDB 1dsz Chain B Binding Site BS02

Receptor Information
>1dsz Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDC
LIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dsz Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		E1253 G1254 R1261 R1284 N1285 R1291
Binding residue
(residue number reindexed from 1)		E26 G27 R34 R57 N58 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dsz, PDBe:1dsz, PDBj:1dsz
PDBsum1dsz
PubMed10698945
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]