Structure of PDB 1di2 Chain B Binding Site BS02

Receptor Information
>1di2 Chain B (length=60) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVGSLQELAVQKGWRLPEYTVAQFTITCRVETFVETGSGTSKQVAKRVA
AEKLLTKFKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1di2 Molecular basis of double-stranded RNA-protein interactions: structure of a dsRNA-binding domain complexed with dsRNA.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
M112 Q118 Q164 K167
Binding residue
(residue number reindexed from 1)
M1 Q7 Q44 K47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1di2, PDBe:1di2, PDBj:1di2
PDBsum1di2
PubMed9857205
UniProtQ91836|PRKAB_XENLA Interferon-inducible double-stranded RNA-dependent protein kinase activator A homolog B (Gene Name=prkra-b)

[Back to BioLiP]