Structure of PDB 1d66 Chain B Binding Site BS02

Receptor Information
>1d66 Chain B (length=57) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d66 DNA recognition by GAL4: structure of a protein-DNA complex.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K17 K18 T50 R51
Binding residue
(residue number reindexed from 1)		K10 K11 T43 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d66, PDBe:1d66, PDBj:1d66
PDBsum1d66
PubMed1557122
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]