Structure of PDB 1d3u Chain B Binding Site BS02

Receptor Information
>1d3u Chain B (length=201) Species: 2262 (Pyrococcus woesei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVSDAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGR
SIESVMAACVYAACRLLKVPRTLDEIADIARVDKKEIGRSYRFIARNLNL
TPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRGLTSGKSPAG
LVAAALYIASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLKIKVPI
A
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d3u The structural basis for the oriented assembly of a TBP/TFB/promoter complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		G1148 G1244 S1246 T1278 V1280 T1281
Binding residue
(residue number reindexed from 1)		G49 G145 S147 T179 V181 T182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0017025 TBP-class protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0070897 transcription preinitiation complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d3u, PDBe:1d3u, PDBj:1d3u
PDBsum1d3u
PubMed10570130
UniProtP61999|TF2B_PYRWO Transcription initiation factor IIB (Gene Name=tfb)

[Back to BioLiP]