Structure of PDB 1cz0 Chain B Binding Site BS02

Receptor Information
>1cz0 Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cz0 A novel endonuclease mechanism directly visualized for I-PpoI.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		A248 P249 V252 G253 K256 N257 T267
Binding residue
(residue number reindexed from 1)		A47 P48 V51 G52 K55 N56 T66
Enzymatic activity
Catalytic site (original residue number in PDB) R261 H298 C305 N319
Catalytic site (residue number reindexed from 1) R60 H97 C104 N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cz0, PDBe:1cz0, PDBj:1cz0
PDBsum1cz0
PubMed10581547
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]