Structure of PDB 1c7u Chain B Binding Site BS02

Receptor Information
>1c7u Chain B (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYNEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c7u Solution structure of the MEF2A-DNA complex: structural basis for the modulation of DNA bending and specificity by MADS-box transcription factors
ResolutionN/A
Binding residue
(original residue number in PDB)		G101 R102 K104 R114
Binding residue
(residue number reindexed from 1)		G1 R2 K4 R14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c7u, PDBe:1c7u, PDBj:1c7u
PDBsum1c7u
PubMed10835359
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]