Structure of PDB 1bua Chain B Binding Site BS02

Receptor Information
>1bua Chain B (length=229) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDEDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKI
AEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKIKFTLGG
YTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRSLKTYNINELNEIPKPYKG
VKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDY
WRNYERTSQLRNDKYNNISEYRNWIYRGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bua Structural and energetic origins of indirect readout in site-specific DNA cleavage by a restriction endonuclease.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		N70 K92 T93 T94 Y95 T106 T111 S112 K119 S183 T186 N188
Binding residue
(residue number reindexed from 1)		N65 K87 T88 T89 Y90 T97 T102 S103 K110 S168 T171 N173
Binding affinityPDBbind-CN: Kd=550nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bua, PDBe:1bua, PDBj:1bua
PDBsum1bua
PubMed10074946
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]