Structure of PDB 1ben Chain B Binding Site BS02

Receptor Information
>1ben Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1ben Chain D (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ben A novel complex of a phenolic derivative with insulin: structural features related to the T-->R transition.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 K29
Binding residue
(residue number reindexed from 1)		G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ben, PDBe:1ben, PDBj:1ben
PDBsum1ben
PubMed8844841
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]