Structure of PDB 1b8i Chain B Binding Site BS02

Receptor Information
>1b8i Chain B (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b8i Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R205 N207 F208 Q247 N250 N254 R258
Binding residue
(residue number reindexed from 1)		R1 N3 F4 Q43 N46 N50 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b8i, PDBe:1b8i, PDBj:1b8i
PDBsum1b8i
PubMed10067897
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]