Structure of PDB 1b7x Chain B Binding Site BS02

Receptor Information
>1b7x Chain B (length=246) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRYERNIEKISMLEKIYIHPRYNWRENLDRDIAL
MKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPSVL
QVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFV
MKSPFNNRWYQMGIVSWGEGCDRDGKIGFYTHVFRLKKWIQKVIDQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b7x Unexpected crucial role of residue 225 in serine proteases.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		H57 W60D N98 L99 D189 A190 S195 S214 W215 G216
Binding residue
(residue number reindexed from 1)		H43 W50 N93 L94 D189 A190 S195 S216 W217 G218
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 E192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H43 D97 E192 G193 D194 S195 G196
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b7x, PDBe:1b7x, PDBj:1b7x
PDBsum1b7x
PubMed10051558
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]